PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7AL_0BCF482E8.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 167aa    MW: 19782.1 Da    PI: 11.1873
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7AL_0BCF482E8.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.2e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg W++eEde+l + ++++G g+W+++++  g+ R++k+c++rw +yl
  Traes_7AL_0BCF482E8.1 14 RGLWSPEEDEKLMNHIAMYGHGCWSSVPKLAGLERCGKSCRLRWINYL 61
                           788*******************************************97 PP

2Myb_DNA-binding54.72.3e-1767111147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rg +++eE++l+++++ +lG++ W+ Ia+ ++ gRt++++k++w++y
  Traes_7AL_0BCF482E8.1  67 RGTFSQEEEDLIIHLHSMLGNK-WSQIAAQLP-GRTDNEVKNFWNSY 111
                            899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.786961IPR017930Myb domain
SuperFamilySSF466892.06E-3011108IPR009057Homeodomain-like
SMARTSM007178.6E-131363IPR001005SANT/Myb domain
PfamPF002498.2E-161461IPR001005SANT/Myb domain
CDDcd001674.53E-101761No hitNo description
PROSITE profilePS5129426.98862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-2765116IPR009057Homeodomain-like
SMARTSM007175.1E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1667111IPR001005SANT/Myb domain
CDDcd001675.31E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MAKQSCCHKK RLRRGLWSPE EDEKLMNHIA MYGHGCWSSV PKLAGLERCG KSCRLRWINY  60
LRPDLKRGTF SQEEEDLIIH LHSMLGNKWS QIAAQLPGRT DNEVKNFWNS YIKKKLRERG  120
IDPATHXXXP RPPPRRPPRA ERSSAMPSSS QQRRRWPRTR WRKCWIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
1h8a_C2e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3544390.0AK354439.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1007F18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003557879.11e-86PREDICTED: myb-related protein 308-like
SwissprotQ8LPH62e-72MYB86_ARATH; Transcription factor MYB86
TrEMBLW5H6561e-118W5H656_WHEAT; Uncharacterized protein
STRINGBRADI1G61397.13e-86(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.38e-75myb domain protein 55
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]